p.chemkody:after{ content:""; display:block; overflow:hidden; clear:both; height:0; } p.chemkody span:nth-of-type(7n+1) { clear: left; } p.chemkody span { float: left; min-width: 90px; margin: 0 20px 0 0; padding: 0 0 10px; color: #6e6e6e; font-family: Courier New,monospace; white-space: nowrap; } Regulatory status:RUO Type:Recombinant Source:Hi-5 Insect cells Other names:TNF 13, TALL 2, TRDL 1, CD256 antigen , A Proliferation-Inducing Ligand, TNFSF13, TRDL-1α Species:Human Type Recombinant Description APRIL, a member of the TNF superfamily, is expressed in monocytes, macrophages, certain transformed cell lines, certain cancers of the colon, and lymphoid tissues. APRIL, along with another TNF family member, BAFF, competes for two receptors, TACI and BCMA. APRIL has the ability to stimulate proliferation of various tumor cell lines, including Jurkat T cells and MCF-7 carcinoma cells. Like BAFF, APRIL also stimulates the proliferation of B and T cells. The human APRIL gene codes for at least four alternatively spliced transcriptional variants, which give rise to different isoforms of the APRIL precursor protein. All isoforms can be cleaved by the protease, furin, to release a soluble C-terminal fragment, which comprises the TNF-like receptor binding of the APRIL precursor. Recombinant human APRIL is a soluble 16.3 kDa protein, consisting of 146 amino acid residues. Amino Acid Sequence AVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL Source Hi-5 Insect cells Purity 95% Biological Activity Measured by its ability to induce cell death in Jurkat cells. Storage/Expiration  –20°C