p.chemkody:after{ content:""; display:block; overflow:hidden; clear:both; height:0; } p.chemkody span:nth-of-type(7n+1) { clear: left; } p.chemkody span { float: left; min-width: 90px; margin: 0 20px 0 0; padding: 0 0 10px; color: #6e6e6e; font-family: Courier New,monospace; white-space: nowrap; } Regulatory status:RUO Type:Recombinant Source:E. coli Other names:Stromal-Cell Derived Factor-1, CXCL12, PBSF Species:Murine Type Recombinant Description SDF-1α and β are stromal-derived, CXC chemokines that signal through the CXCR4 receptor. SDF-1α and β chemoattract B and T cells, and have been shown to induce migration of CD34+ stem cells. Additionally, the SDF-1 proteins exert HIV-suppressive activity in cells expressing the CXCR4 receptor. Human and murine SDF-1 proteins act across species. SDF-1α and β contain the four highly conserved cysteine residues present in CXC chemokines. The mature SDF-1α protein is the result of alternative splicing of the SDF-1 gene and contains 68 amino acid residues. Recombinant Murine SDF-1α is a 7.9 kDa protein containing 68 amino acid residues. Amino Acid Sequence KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK Source E. coli Purity 98% Biological Activity Determined by its ability to chemoattract human peripheral blood monocytes using a concentration of 50–100 ng/ml. Endotoxin Endotoxin level is <0.1 ng/μg of protein (<1EU/μg). Reconstitution Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C. Storage/Expiration  –20°C