Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI waterData: Availability 1-3 business days Species Reactivity Human Format Antigen affinity purified Clonality Polyclonal (rabbit origin) Isotype Rabbit IgG Purity Antigen affinity Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide UniProt P20073 Applications Western Blot : 0.5-1ug/ml Limitations This Annexin VII antibody is available for research use only. Description:ANXA7 (Annexin A7), also known as ANX7 or SNX, is a protein that in humans is encoded by the ANXA7 gene. Annexin VII is a member of the annexin family of calcium-dependent phospholipid binding proteins. This gene is mapped to 10q21.1-q21.2 by study of somatic cell hybrids and by in situ hybridization. The ANX7 gene exhibits many biologic and genetic properties expected of a tumor suppressor gene and may play a role in prostate cancer progression. Based on studies of recombinant human ANXA7 and isolated bovine chromaffin cells, it is showed that ANXA7 is a Ca(2+)-dependent GTP binding protein. ANXA7 was active in a chromaffin granule aggregation assays in the presence of Ca(2+) and GTP, and was deactivated upon GTP hydrolysis.Application Notes:Optimal dilution of the Annexin VII antibody should be determined by the researcher.Immunogen:Amino acids 434-466 (TDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTL) from the human protein were used as the immunogen for the Annexin VII antibody.Storage:After reconstitution, the Annexin VII antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.