tech_banner
JPT/E22G-Beta-Amyloid (1-42); HFIP treated (0.1mg)/SP-Ab-11_0.1/

E22G-Beta-Amyloid (1-42); HFIP treated (0.1mg)

Product Code: SP-Ab-11_0.1

Arctic variant of human Amyloid beta A4 protein, where Glu 22 is replaced by a Glycine (Gly) (Swiss-Prot ID: P05067, natural variant). HFIP treatment is performed to disrupt β-sheet and other unwanted secondary structures.Amino Acid Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIAProtein Name: Amyloid beta (A4) (alternative names: Abeta, Beta amyloid, APP)Amount: 1 vial (0.1 mg) Purity: >95% (HPLC-MS) Delivery Format: Freeze dried in plastic vials Application(s): In vitro staining, Western Blot, Binding experiments Indication(s)/Topic(s): Neurodegenerative disease, Alzheimers diseaseDelivery Time: 2-5 days

JPTs Single Catalog Peptides JPT Peptide Technologies has substantial, long-standing expertise in providing peptides, peptidomimetics, and proteins to the global scientific community. Our highly skilled and committed scientific staff ensures that the most appropriate methods and techniques are selected for every synthesis project. All of JPTs catalog peptides are provided with HPLC-MS analyses to confirm the identity and demonstrate the high quality of our peptides.

Benefits of JPTs Single Catalog Peptides - Whole production performed in a regulated European environment according to DIN EN ISO 9001:2015 & GCLP standards; audits welcome! - Synthesis protocols designed to avoid toxic contaminants and side products - Provision of freeze dried aliquots for enhanced stability - Proven track record for applications in clinical studies

E22G-Beta-Amyloid (1-42); HFIP treated (0.1mg)

Selected References \"Competitive Mirror Image Phage Display Derived Peptide Modulates Amyloid Beta Aggregation and Toxicity\" Rudolph et al., PLoS One. (2016) - PMID: 26840229\"Inhibition of the Cardiac Na+ Channel α-subunit Nav1. 5 by Propofol and Dexmedetomidine\"Stoetzer et al., Naunyn Schmiedebergs Arch Pharmacol. - PMID: 26667357\"Aβ-42 lowering Agents From the Marine-Derived Fungus Dichotomomyces Cejpii\"Harms et al., Steroids. (2015) - PMID: 26440473\"η-Secretase Processing of APP Inhibits Neuronal Activity in the Hippocampus\"Willem et al., Nature (2015) - PMID: 26322584\"Hybridization of an Aβ-specific Antibody Fragment with Aminopyrazole-based β Sheet Ligands Displays Striking Enhancement of Target Affinity\"Hellmert et al., Org. Biomol. Chem. (2015) - PMID: 25613910

Application Note \"Synthetic Amyloid Beta Peptides Aid Alzheimer Investigation\" Broersen et al., Application Note (2013) (full text)

Testimonial\"Our group focuses on the in vitro study of risk factors in Alzheimer’s disease and, as we experienced that the in-house expression and production of the amyloid beta peptide is notoriously difficult, we are continuously dependent on a high quality supply of a large variety of these peptides from commercial source. We started our collaboration with JPT with their request to test a range of their peptides for the ability to produce toxic oligomers and fibrillar networks and were impressed by the rapid supply of a very wide range of high purity peptides with excellent fibril forming properties and toxicity profiles. JPT has shown real valuable know-how and experience in the field of peptide synthesis by their ability to generate high quality preparations of amyloid beta peptide variants which are known for their difficulty to handle.\"Kerensa Broersen, Assistant Prof., Nanobiophysics Group, University of Twente, Enschede, The Netherlands

E22G-Beta-Amyloid (1-42); HFIP treated (0.1mg)

Technical Data:
Protein Name Amyloid beta (A4) protein
Organism Homo sapiens (Human)
Indication / Topic Alzheimers disease
Number of peptides 1
Further Information:
Amount 1 vial containing 0,1 mg
Specifications Point mutated synthetic Beta-Amyloid peptide (1-42)
Documentation Product Datasheet
Swiss-Prot ID P05067
NCBI NP_000475.1
Sequence DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA