Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 (also known as Glutamate receptor 2, AMPA-selective glutamate receptor 2, Glutamate receptor ionotropic AMPA 2, GluR-B, GluR-K2 and Gria2, accession number P19491)Mouse: 98% identity (49/50 amino acids identical)Human: 98% identity (49/50 amino acids identical)100% identity between Flip and Flop isoforms>70% identity with GluA3/GluR3 and less identity with GluA1/GluR1 and GluA4/GluR4
Specifications:
![\"\"](\"/plp/mm/spacer.gif\"){kind=spacer} | GluA2/GluR2 glutamate receptor
| |
| | Immunoblot (IB) Immuno-gold EM Immunohistochemistry (IHC)
| |
| | L21/32
| |
| | IgG1
| |
| | Human (H) Mouse (M) Rat (R)
| |
| | Br-IB Br-IHC KO T
| |
| | TC Supernatant
| |
| | 5 mL
| |
| | Does not cross-react with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results)
| |
| | 90 kDa
| |
| | Mouse (M)
| |
| | Unlabeled
| |
| | Monoclonal
| |
| | 390
| |
| | 175
| |
| | Per Contract(QUOTE)
| |
| | RRID:AB_10674575
| |
