Immunogen:Fusion protein amino acids 717-907 (cytoplasmic C-terminus) of rat Kv2.2 long isoform (also known as Potassium voltage-gated channel subfamily B member 2, Kcnb2 and CDRK, accession number NP_446452.2)Mouse: 94% identity (180/191 amino acids identical)Human: 84% identity (161/191 amino acids identical)<50% identity with Kv2.1 and other Kv2 channels100% identity with Kv2.2 short isoform for first 47 amino acids(ENRGSAPQTPPSTARPLPVTTADFPLTTPQHMSTILLEEALPQGQRP)
Specifications:
![\"\"](\"/plp/mm/spacer.gif\"){kind=spacer} | Kv2.2 potassium channel
| |
| | K+ Channels
| |
| | Immunoblot (IB) Immunocytochemistry (ICC) Immunohistochemistry (IHC)
| |
| | N372B/1
| |
| | IgG1
| |
| | Human (H) Mouse (M) Rat (R)
| |
| | Br-IB Br-IHC KO T
| |
| | Purified
| |
| | 100 ul
| |
| | Does not cross-react with Kv2.2 short isoformDoes not cross-react with Kv2.1
| |
| | 120 kDa
| |
| | Mouse (M)
| |
| | Unlabeled
| |
| | Monoclonal
| |
| | 450
| |
| | 200
| |
| | Per Contract(QUOTE)
| |
| | RRID:AB_2315870
| |
