tech_banner
HumanZyme/BMP-10 (Bone Morphogenetic Protein-10)/HZ-7201/2 µg

Product Description:

Bone morphogenetic proteins (BMPs) constitute a subfamily within the TGF-β superfamily of structurally related signaling proteins. Members of this superfamily are widely distributed throughout the body and are involved in diverse physiological processes during both pre- and postnatal life. BMP-10 plays a crucial role in the development of the embryonic heart by acting to stimulate and maintain cardiomyocyte proliferation. It can signal through various receptor complexes usually containing BMPR-1A, BMPR-1B, ALK1, ALK3, or ALK6. The interaction of BMP-10 with its specific receptors can induce signaling initiated by the phosphorylation of SMAD transcription factors, including SMAD1, SMAD5, or SMAD8, but can also induce SMAD independent processes. BMP-10 is structurally related to BMP-9, and both can inhibit endothelial cell proliferation and migration.

Technical Specifications:

  • Species: Human
  • Expression: HEK293 Cell Expressed
  • Activity: Typically 4.0-6.0 ng/ml ED50
  • Purity: ≥95%
  • Endotoxin: <1.0 EU/μg
  • Molecular Mass: 24.4 kDa
  • Formulation: 10mM Sodium Citrate, pH 2.7 + 75mM NaC
  • Country of Origin: USA

Purity Confirmation:

This was determined by SDS-PAGE gel and HPLC analysis.

Activity Assay:

Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells.

AA Sequence:

NAKGNYCKRTPLYIDFKEIGWDSWIIAPPG
YEAYECRGVCNYPLAEHLTPTKHAIIQALV
HLKNSQKASKACCVPTKLEPISILYLDKGV
VTYKFKYEGMAVSECGCR

Reconstitution Buffer:

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex.

Storage:

For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% HSA) and store in working aliquots at -20°C to -80°C.