tech_banner
HumanZyme/Sonic Hedgehog (SHH)/HZ-7211/1000 µg

 Product Description:

Members of the Hedgehog (Hh) family are highly conserved proteins that are widely represented throughout the animal kingdom. The three known mammalian Hh proteins, Sonic (Shh), Desert (Dhh) and Indian (Ihh), are structurally related, and share a high degree of amino acid sequence identity (e.g. Shh and Ihh are 93% identical). The biologically active form of each Hh molecule is obtained by autocatalytic cleavage of their precursor proteins, and each corresponds to approximately one half of the N-terminal portion of the precursor molecule. Although Hh proteins have unique expression patterns and distinct biological roles within their respective regions of secretion, they use the same signaling pathway and can be substituted for one another in experimental systems. Recombinant E. coli-derived Human Sonic Hedgehog is a 20.0 kDa protein consisting of 176 amino acid residues, including an N-terminal Ile-Val-Ile sequence substituted for the naturally occurring, chemically modified, Cys residue.

Technical Specifications:

  • Species: Human
  • Expression: E. coli Cell Expressed
  • Activity: Typically 0.8-1.0 μg/ml ED50
  • Purity: ≥98%
  • Endotoxin: <1.0 EU/μg
  • Molecular Mass: 20.0 kDa
  • Country of Origin: USA

Purity Confirmation:

This was determined by SDS-PAGE gel and HPLC analysis.

Activity Assay:

Determined by its ability to induce alkaline phosphatase production by C3H/10T1/2 (CCL-226) cells.

AA Sequence:

IVIGPGRGFGKRRHPKKLTPLAYKQFIPNV
AEKTLGASGRYEGKISRNSERFKELTPNYN
PDIIFKDEENTGADRLMTQRCKDKLNALAI
SVMNQWPGVKLRVTEGWDEDGHHSEESLHY
EGRALDITTSDRDRSKYGMLARLAVEAGFD
WVYYESKAHIHCSVKAENSVAAKSGG

Reconstitution Buffer:

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex.

Storage:

For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% HSA) and store in working aliquots at -20°C to -80°C.