tech_banner
HumanZyme/sCD40 Ligand (soluble CD40 Ligand)/HZ-7106/250 µg

 Product Description:

CD40, a member of the TNF receptor family, is a cell surface protein expressed on B cells, dendritic cells, monocytes, thymic epithelial cells and, at low levels, on T cells. Signaling though CD40 plays an important role in the proliferation and differentiation of B cells, and is critical for immunoglobulin (Ig) class switching. The membrane-anchored CD40-Ligand is expressed almost exclusively on activated CD4+ T lymphocytes. Failure to express CD40L leads to “immunodeficiency with hyper-IgM”, a disease characterized by failure to produce IgG, IgA and IgE. The human CD40L gene codes for a 261 amino acid type II transmembrane protein, which contains a 22 amino acid cytoplasmic domain, a 24 amino acid transmembrane domain, and a 215 amino acid extracellular domain.

Technical Specifications:

  • Species: Human
  • Expression: E. coli Cell Expressed
  • Activity: Assay 1: N/A
  • Assay 2: Typically 5-10 ng/mL ED50
  • Purity: ≥98%
  • Endotoxin: <1.0 EU/μg
  • Molecular Mass: 16.3 kDa
  • Formulation: 10mM Sodium Phosphate, pH 7.5
  • Country of Origin: USA

Purity Confirmation:

This was determined by SDS-PAGE gel and HPLC analysis

Activity Assay:

Assay#1: Determined by the stimulation of IL-12 induction by human PBMCs.

Assay#2: Determined by the dose-dependent stimulation of IL-8 production by human PBMC. The expected ED50 for this effect is 5-10 ng/ml.

Note: Results may vary with PBMC donors.

AA Sequence:

MQKGDQNPQIAAHVISEASSKTTSVLQWAE
KGYYTMSNNLVTLENGKQLTVKRQGLYYIY
AQVTFCSNREASSQAPFIASLWLKSPGRFE
RILLRAANTHSSAKPCGQQSIHLGGVFELQ
PGASVFVNVTDPSQVSHGTGFTSFGLLKL

Reconstitution Buffer:

Centrifuge the vial prior to opening. Reconstitute in 5-10 mM Sodium Phosphate, pH 7.5 to a concentration of 0.1-1.0 mg/ml. Do not vortex.

Storage:

For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% HSA) and store in working aliquots at -20°C to -80°C.