tech_banner
HumanZyme/GDNF (Glial-Derived Neurotrophic Factor)/HZ-7030/100 µg

Product Description:

GDNF is a disulfide-linked, homodimeric neurotrophic factor structurally related to Artemin, Neurturin and Persephin. These proteins belong to the cysteine-knot superfamily of growth factors that assume stable dimeric protein structures. GDNF signals through a multicomponent receptor system, composed of a RET and one of the four GFRα (α1-α4) receptors. GDNF specifically promotes dopamine uptake and survival, and morphological differentiation of midbrain neurons. Using a Parkinson’s disease mouse model, GDNF has been shown to improve conditions such as bradykinesia, rigidity, and postural instability. The functional human GDNF ligand is a disulfide-linked homodimer consisting of two 15 kDa polypeptide chains called monomers. Each monomer contains seven conserved cysteine residues, including Cys-101, which is used for inter-chain disulfide bridging, and others that are involved in the intramolecular ring formation known as the cysteine knot configuration.

Technical Specifications:

  • Species: Human
  • Expression: E. coli Cell Expressed
  • Activity: Typically 1.0-10.0 ng/mL ED50
  • Purity: >98%
  • Endotoxin: <1.0 EU/μg
  • Molecular Mass: 30.4 kDa, homodimeric
  • Formulation: 10 mM Sodium Citrate + 150 mM NaCl
  • Country of Origin: USA

Purity Confirmation:

This was determined by SDS-PAGE gel and HPLC analysis

Activity Assay:

Determined by a cell proliferation assay using SH-SY5Y cells.

AA Sequence:

MSPDKQMAVLPRRERNRQAAAANPENSRGK
GRRGQRGKNRGCVLTAIHLNVTDLGLGYET
KEELIFRYCSGSCDAAETTYDKILKNLSRN
RRLVSDKVGQACCRPIAFDDDLSFLDDNLV
YHILRKHSAKRCGCI

Reconstitution Buffer:

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex.

Storage:

For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% HSA) and store in working aliquots at -20°C to -80°C.