tech_banner
HumanZyme/EGF (Epidermal Growth Factor)/HZ-7014/1000 µg

Product Description:

EGF is a potent growth factor that stimulates the proliferation of various epidermal and epithelial cells. Additionally, EGF has been shown to inhibit gastric secretion, and to be involved in wound healing. EGF signals through a receptor known as c-erbB, which is a class I tyrosine kinase receptor. This receptor also binds with TGF-α and VGF (vaccinia virus growth factor). Recombinant Human EGF is a 6.2 kDa globular protein containing 53 amino acid residues, including 3 intramolecular disulfide bonds.

Technical Specifications:

  • Species: Human
  • Expression: E. coli Cell Expressed
  • Activity: Typically ≤0.1 ng/mL ED50
  • Purity: ≥98%
  • Endotoxin: <1.0 EU/μg
  • Molecular Mass: 6.2 kDa
  • Country of Origin: USA

Purity Confirmation:

This was determined by SDS-PAGE gel and HPLC analysis.

Activity Assay:

Determined by its ability to stimulate the proliferation of mouse Balb/c 3T3 cells.

AA Sequence:

NSDSECPLSHDGYCLHDGVCMYIEALDKYA
CNCVVGYIGERCQYRDLKWWELR

Reconstitution Buffer:

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex.

Storage:

For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% HSA) and store in working aliquots at -20°C to -80°C.