tech_banner
HumanZyme/Adiponectin/HZ-7176/5 µg

Product Description:

Adiponectin is an adipose-derived secreted protein containing 226 amino acid residues. It is relatively abundant in humans and rodents, accounting for about 0.01% of total plasma protein. The circulating levels of adiponectin are decreased under conditions of obesity, insulin resistance, and type II diabetes. Disruption of adiponectin in mice causes insulin resistance and neointimal formation. Conversely, administration of recombinant adiponectin suppresses hepatic glucose production, and reverses insulin resistance associated with both lipoatrophy and obesity. The protective role of adiponectin is attributed to its anti-inflammatory properties (e.g. ability to suppress expression of TNF-α and class A scavenger receptor in macrophages). Recombinant adiponectin is a multimeric glycoprotein containing amino acids Glu-19 to Asn-244 of the adiponectin precursor protein fused to an N-terminal histidine tag.

Technical Specifications:

  • Species: Human
  • Expression: Insect Cell Expressed
  • Activity: Typically 3.0-6.0 μg/ml ED50
  • Purity: ≥97%
  • Endotoxin: <1.0 EU/μg
  • Molecular Mass: 25.9 kDa
  • Formulation: 10mM Tris, pH 8.5 + 75mM L-Arginine
  • Country of Origin: USA

Purity Confirmation:

This was determined by SDS-PAGE gel and HPLC analysis.

Activity Assay:

Determined by a cytotoxic assay using M1 cells.

AA Sequence:

RGHHHHHHHHETTTQGPGVLLPLPKGACTG
WMAGIPGHPGHNGAPGRDGRDGTPGEKGEK
GDPGLIGPKGDIGETGVPGAEGPRGFPGIQ
GRKGEPGEGAYVYRSAFSVGLETYVTIPNM
PIRFTKIFYNQQNHYDGSTGKFHCNIPGLY
YFAYHITVYMKDVKVSLFKKDKAMLFTYDQ
YQENNVDQASGSVLLHLEVGDQVWLQVYGE
GERNGLYADNDNDSTFTGFLLYHDTN

Reconstitution Buffer:

Reconstitute in water to a concentration of 1.0 mg/ml. Allow the reconstituted vial to sit at room temperature for 1 hour before use. Do not vortex.

Storage:

For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% HSA) and store in working aliquots at -20°C to -80°C.