tech_banner
HumanZyme/IL-13 (Interleukin-13)/HZ-7129/2 µg

Product Description:

IL-13 is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching, resulting in increased production of IgE. Blocking of IL-13 activity inhibits the pathophysiology of asthma. Human and murine IL-13 are cross-species reactive.

Technical Specifications:

  • Species: Human
  • Expression: E. coli Cell Expressed
  • Activity: Typically ≤1.0 ng/mL ED50
  • Purity: ≥98%
  • Endotoxin: <1.0 EU/μg
  • Molecular Mass: 12.6 kDa
  • Formulation: 20mM Sodium Phosphate, pH 7.0
  • Country of Origin: USA

Purity Confirmation:

This was determined by SDS-PAGE gel and HPLC analysis.

Activity Assay:

Determined by its ability to stimulate the proliferation of human TF-1 cells.

AA Sequence:

MSPGPVPPSTALRELIEELVNITQNQKAPL
CNGSMVWSINLTAGMYCAALESLINVSGCS
AIEKTQRMLSGFCPHKVSAGQFSSLHVRDT
KIEVAQFVKDLLLHLKKLFREGRFN

Reconstitution Buffer:

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Slow to dissolve. Do not vortex.

Storage:

This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% HSA) and store in working aliquots at -20°C to -80°C.