Catalog No. Size

50183P-2 2ug

50183P-10 10ug

50183P-50 50ug

50183P-100 100ug

50183P-1000 1000ug

CCL28, also known as Mucosae-associated Epithelial Chemokine (MEC), is secreted by gastrointestinal and non-intestinal mucosal cells. It regulates chemotaxis of cells expressing surface receptors CCR3 and CCR10. This chemokine is constitutively expressed in the colon, but its levels can be increased by pro-inflammatory cytokines and certain bacterial products implying a role in effector cell recruitment to sites of epithelial injury. CCL28 has also been implicated in the migration of IgA-expressing cells to the mammary gland, salivary gland, intestine and other mucosal tissues. It has also been shown as a potential antimicrobial agent effective against certain pathogens, such as Gram negative and Gram positive bacteria and the fungus Candida albicans.

Source: Recombinant human CCL28, produced in E. coli, corresponds to aa 23- 127 (accession no. Q9NRJ3).

Protein Sequence: ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRR ICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQG KHETYGHKTPY

Molecular Mass: 12.073kDa by Mass Spec.

Purity: >97%

Activity: EC50 = 38nM determined by Migration Assay in L1.2 cells expressing CCR10.

Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.

Form: Lyophilized.

Carrier Protein: None.

Reconstitution: Recommended at 100ug/ml in sterile distilled water.

Stability and Storage: 12 months from date of receipt, -20oC to -70oC, as supplied.

1 month, 2oC to 8oC, under sterile conditions after reconstitution.

3 months, -20oC to -70oC, under sterile conditions after reconstitution.

For in vitro investigational use only. Not for use in diagnostic or therapeutic procedures.