Catalog No. Size #1112 Anti-Human CCR5 Antibody 50189PB-2 2ug

50189PB-10 10ug

50189PB-50 50ug

50189PB-100 100ug

CCL7, also known as Monocyte Chemotactic Protein-3 (MCP-3), is a secreted chemokine that attracts macrophages, monocytes, and eosinophils during inflammation and metastasis. It is a member of the C-C subfamily of chemokines which are characterized by having two adjacent cysteine residues. In vivo, this protein is a substrate of matrix metalloproteinase 2 (MMP2), an enzyme that degrades components of the extracellular matrix. The gene that encodes CCL7 is part of a cluster of C-C chemokine family members on chromosome 17q. CCL7 binds to CCR1, CCR2, and CCR3 receptors and appears to be an antagonist for the CCR5 receptor.

Source: Recombinant human CCL7 is produced in E. coli (accession no.

P80098).

Modification: Biotinylated

Protein Sequence: QPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCPREAVIFK TKLDKEICADPTQKWVQDFMKHLDKKTQTPKLKLGSGLNDIFE AQKIEWHE

Molecular Mass: 11.2kDa by Mass Spec.

Purity: >97% by SDS-PAGE

Activity: EC50 = 1.4-2.6nM determined by migration of recombinant CCR2- expressing cells.

Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.

Form: Lyophilized.

Carrier Protein: None.

Reconstitution: Recommended at 100ug/ml in sterile distilled water.

Stability and Storage: 12 months from date of receipt, -20oC to -70oC, as supplied.

1 month, 2oC to 8oC, under sterile conditions after reconstitution.

3 months, -20oC to -70oC, under sterile conditions after reconstitution.

For in vitro investigational use only. Not for use in diagnostic or therapeutic procedures.