Recombinant CCL7 (MCP-3)ORDERING INFORMATIONRELATED PRODUCTSORDERING INFORMATIONRELATED PRODUCTS
Catalog No. Size #1112 Anti-Human CCR5 Antibody 50188P-2 2ug
50188P-10 10ug
50188P-50 50ug
50188P-100 100ug
50188P-1000 1000ug
BACKGROUNDBACKGROUNDCCL7, also known as Monocyte Chemotactic Protein-3 (MCP-3), is a secreted chemokine that attracts macrophages, monocytes, and eosinophils during inflammation and metastasis. It is a member of the C-C subfamily of chemokines which are characterized by having two adjacent cysteine residues. In vivo, this protein is a substrate of matrix metalloproteinase 2 (MMP2), an enzyme that degrades components of the extracellular matrix. The gene that encodes CCL7 is part of a cluster of C-C chemokine family members on chromosome 17q. CCL7 binds to CCR1, CCR2, and CCR3 receptors and appears to be an antagonist for the CCR5 receptor.
DESCRIPTIONDESCRIPTIONSource: Recombinant human CCL7 is produced in E. coli (accession no.
P80098).
Protein Sequence: QPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCPREAVIFK TKLDKEICADPTQKWVQDFMKHLDKKTQTPKL
Molecular Mass: 8.956kDa by Mass Spec.
Purity: >97% by SDS-PAGE
Activity: EC50 = 0.91nM determined by migration of recombinant CCR2- expressing cells.
Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.
Form: Lyophilized.
Carrier Protein: None.
PREPARATION AND STORAGEPREPARATION AND STORAGEReconstitution: Recommended at 100ug/ml in sterile distilled water.
Stability and Storage: 12 months from date of receipt, -20oC to -70oC, as supplied.
1 month, 2oC to 8oC, under sterile conditions after reconstitution.
3 months, -20oC to -70oC, under sterile conditions after reconstitution.
For in vitro investigational use only. Not for use in diagnostic or therapeutic procedures.