Recombinant CCL14 (HCC-1)ORDERING INFORMATIONORDERING INFORMATION
Catalog No. Size
50192P-2 2ug
50192P-10 10ug
50192P-50 50ug
50192P-100 100ug
50192P-1000 1000ug
BACKGROUNDBACKGROUNDCCL14, also known as Hemofiltrate CC Chemokine-1 (HCC-1) is a small cytokine (~8kDa) that is constitutively expressed in multiple tissues. Upon processing of the N-terminal residues of full- length HCC-1 by the uPA-plasmin system, the active form of HCC-1 is a strong agonist for CCR1, CCR5, and, to a lesser extent, CCR3. CCL14 causes chemotaxis of different types of leukocytes, and its active form is a potent inhibitor of HIV entry.
DESCRIPTIONDESCRIPTIONSource: Recombinant human CCL14 is produced in E. coli (accession no.
Q16627, aa 28-93).
Protein Sequence: GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVC TNPSDKWVQDYIKDMKEN
Molecular Mass: 7.801kDa by Mass Spec.
Purity: >97% by SDS-PAGE
Activity: EC50 = 0.1-0.4nM determined by Migration Assay in cells expressing CCR1.
Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.
Form: Lyophilized.
Carrier Protein: None.
PREPARATION AND STORAGEPREPARATION AND STORAGEReconstitution: Recommended at 100ug/ml in sterile distilled water.
Stability and Storage: 12 months from date of receipt, -20oC to -70oC, as supplied.
1 month, -20oC to -70oC, under sterile conditions after reconstitution. Best if used immediately after reconstitution.
Avoid multiple freeze-thaw cycles.
For in vitro investigational use only. Not for use in diagnostic or therapeutic procedures.
