Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI waterData: Availability 1-3 business days Species Reactivity Human, Rat Format Antigen affinity purified Clonality Polyclonal (rabbit origin) Isotype Rabbit IgG Purity Antigen affinity Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide UniProt Q9NRK6 Applications Western blot : 0.5-1ug/ml Limitations This ABCB10 antibody is available for research use only. Description:ABCB10, also known as M-ABC2, is expressed as a 65-kD nonglycosylated mitochondrial membrane protein. This ABCB10 gene is mapped to 1q42.13. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown.Application Notes:Optimal dilution of the ABCB10 antibody should be determined by the researcher.Immunogen:Amino acids 640-678 (QRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDR) from the human protein were used as the immunogen for the ABCB10 antibody.Storage:Prior to reconstitution, store at 4oC. After reconstitution, the ABCB10 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.