Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI waterData: Availability 1-3 business days Species Reactivity Human, Mouse, Rat Format Antigen affinity purified Clonality Polyclonal (rabbit origin) Isotype Rabbit IgG Purity Antigen affinity Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide UniProt Q9UNQ0 Applications Western blot : 0.1-0.5ug/mlIHC (FFPE) : 0.5-1ug/ml IHC (Frozen) : 0.5-1ug/mlICC (FFPE) : 0.5-1ug/ml Limitations This BCRP antibody is available for research use only. Description:ABCG2(Atp-binding cassette, subfamily g, member 2) also known as ABCP, BCRP or MRX, is a protein that in humans is encoded by the ABCG2 gene. The ABCG2 gene encodes a membrane transporter belonging to the ATP-binding cassette (ABC) superfamily of membrane transporters, which are involved in the trafficking of biologic molecules across cell membranes. The ABCG2 protein is also a high capacity transporter for uric acid excretion in the kidney, liver, and gut. The ABCG2 gene is mapped on 4q22.1. In vitro assays of isolated membrane preparations revealed a high-capacity, vanadate-sensitive ATPase activity associated with ABCG2 expression that was stimulated by compounds known to be transported by this protein. Ozvegy et al. (2001) concluded that ABCG2 is likely functioning as a homodimer or homooligomer in this expression system since it is unlikely that putative Sf9 transport partners would be overexpressed at similarly high levels.Abcg2 transports pheophorbide-a, which occurs in various plant-derived foods and food supplements and is highly efficient in limiting its uptake from ingested food. ABCG2 is a major factor in the concentrative transfer of drugs, carcinogens, and dietary toxins to the milk of mice, cows, and humans.Application Notes:Optimal dilution of the BCRP antibody should be determined by the researcher.Immunogen:Amino acids RENLQFSAALRLATTMTNHEKNERINRVIQEL of human ABCG2 were used as the immunogen for the BCRP antibody.Storage:After reconstitution, the BCRP antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.