Everest Biotech/Recombinant Mouse SERPIN F1 50μg/3708980501/50μg-蚂蚁淘生物

Serpin F1 is secreted Neurotrophic protein and belongs to the serpin family. Serpin F1 Highly expressed in the liver, gastric glandular mucosa and renal tubules. It is also expressed in the brain, heart, lung retina and testes. It induces extensive neuronal differentiation in retinoblastoma cells. It is potent inhibitor of angiogenesis. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, exhibits no serine protease inhibitory activity. E.coliPigment epithelium-derived factor, Pedf, Sdf3, Caspin, Serpin F1, Stromal cell-derived factor 3.P97298Lyophilized from a 0.2 μM filtered solution of PBS, pH 7.4The product is shipped at ambient temperature. Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 3X PBS. Please aliquot the reconstituted solutionLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 5 months.Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Less than 0.1 ng/µg (1 IEU/µg).MDPFFKVPVNKLAAAVSNFGYDLYRLRSSASPTGNVLLSPLSVATALSALSLGAEHRTESVIHRA LYYDLITNPDIHSTYKELLASVTAPEKNLKSASRIVFERKLRVKSSFVAPLEKSYGTRPRILTGN PRVDLQEINNWVQAQMKGKIARSTREMPSALSILLLGVAYFKGQWVTKFDSRKTTLQDFHLDEDR TVRVPMMSDPKAILRYGLDSDLNCKIAQLPLTGSMSIIFFLPLTVTQNLTMIEESLTSEFIHDID RELKTIQAVLTVPKLKLSFEGELTKSLQDMKLQSLFESPDFSKITGKPVKLTQVEHRAAFEWNEE GAGSSPSPGLQPVRLTFPLDYHLNQPFLFVLRDTDTGALLFIGRILDPSST

Source

Names

Accession #

Formulation

Shipping

Reconstitution

Storage

Purity

Endotoxin

Amino Acid Sequence

友情链接