Tested Species Reactivity:HumanPredicted Species Reactivity:Cow, Human, Pig, RatProduct Format:Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.Clonality:PolyclonalHost:RabbitApplication:WBReconstitution and Storage:For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.Gene Symbol:POU3F2Official Gene Full Name:POU class 3 homeobox 2NCBI Gene Id:5454Protein Name:POU domain, class 3, transcription factor 2Swissprot Id:P20265Protein Accession #:NP_005595Nucleotide Accession #:NM_005604Alias Symbols:BRN2, OCT7, OTF7, OTF-7, POUF3, brn-2, oct-7Replacement Item:This antibody may replace item sc-31983 from Santa Cruz Biotechnology.Description of Target:N-Oct-3 (POU3F2) is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1) and Oct2 (POU2F2), and the pituitary protein Pit1 (PIT1). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression. N-Oct-3 is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1; MIM 164175) and Oct2 (POU2F2; MIM 164176), and the pituitary protein Pit1 (PIT1; MIM 173110). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression.[supplied by OMIM].Protein Size (# AA):443 Molecular Weight:47kDaPurification:Affinity PurifiedTissue Tool:Find tissues and cell lines supported by DNA array analysis to express POU3F2. RNA Seq:Find tissues and cell lines supported by RNA-seq analysis to express POU3F2. Immunogen:The immunogen is a synthetic peptide directed towards the C terminal region of human POU3F2Predicted Homology Based on Immunogen Sequence:Cow: 100%; Human: 100%; Pig: 100%; Rat: 100%Complete computational species homology data:Anti-POU3F2 (P100858_P050)Peptide Sequence:Synthetic peptide located within the following region: QLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTPConcentration:Batch dependent within range: 100 ul at 0.5 - 1 mg/mlProtein Interactions:UBC; TBP; SOX10; POU3F2; PAX3; GTF2B; EP300; SOX11; PQBP1; POU3F4;Blocking Peptide:For anti-POU3F2 (P100858_P050) antibody is Catalog # AAP31219 (Previous Catalog # AAPP01964)Datasheets/Manuals:Printable datasheet for anti-POU3F2 (P100858_P050) antibody