Type
Recombinant
Description
LIGHT belongs to the TNF family of ligands, and can signal through the herpes virus entry mediator type A receptor (HVEM, TNFRSF14), LTβR, or bind to a decoy receptor, DcR3. It is expressed in splenocytes, activated PBL, CD8+ tumor infiltrating lymphocytes, granulocytes, and monocytes. LIGHT has the ability to active NF-κB, to co-stimulate the activation of lymphocytes and to induce apoptosis in certain human tumor cells. The human LIGHT gene encodes for a 240 amino acid type II transmembrane protein containing a 37 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain, and a 182 amino acid extracellular domain. Recombinant Human LIGHT has a calculated mass of 19.3 kDa, containing 177 amino acid residues. Due to glycosylation, LIGHT migrates between 20.0–22.5 kDa by SDS-PAGE under non-reducing conditions.
Amino Acid Sequence
RLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Source
Hi-5 Insect cells
Purity
95%
Biological Activity
Determined by its cytotoxic effect on HT-29 cells (human colon adenocarcinoma cells) in the presence of human IFN-ɣ.
Endotoxin
Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).
Reconstitution
Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.
Storage/Expiration
–20°C
