Species: Human Host Species: E. coli MW: 80 kDa Genbank #: P40225 a.a: 22–353 Background:Thrombopoietin (TPO), known also as TSF (thrombopoiesis stimulating factor), for mediator substances that function as natural stimulators of megakaryocytopoiesis and thus, promote the differentiation of platelets. TPO stimulates an increase in the sizes and numbers of megakaryocytes. It also increases the number of small acetyl-cholinesterase positive cells that are early precursor cells of the megakaryocytic lineage. TPO is a protein of 332 amino acids that shows significant homology with Epo (erythropoietin) in its N-terminal domain. A comparison of human and porcine TPO sequences shows 83 % identity between the erythropoietin-like domains but only 67 % between the C- terminal domains. Description:Recombinant TPO is disulfide-linked monomer protein consisting of 332 amino acid residues, and migrates due to glycosylation as an approximately 80 kDa protein under non-reducing conditions and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human TPO erythropoeitin domain was expressed in Chinese Hamster Ovary cells. UniProt P07202 Synonym(s): TPO, Thrombopoietin, MGDF, Megakaryocyte Growth And Development Factor, MKCSF, TSF, thrombopoiesis stimulating factor Purity: ≥98% by SDS-PAGE and HPLC Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method. Biological Activity: The ED₅₀ was determined by the dose-dependent proliferation of Mo7e cells to be in the range of 1.0-2.0 ng/ml. Formulation: Lyophilized from a 0.2 µm filtered PBS solution, pH 7. Format: lyophilized protein Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid. Storage / Stability:

The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Reference(s): 1. Lupia E, et al. Mediators Inflamm. 2012,2012:390892.2. Basciano PA, Bussel JB. Curr Opin Hematol. 2012 Sep,19(5):392-8. 3. de Graaf CA, Metcalf D. Cell Cycle. 2011 May 15,10(10):1582-9. Warning(s): Avoid freeze/thaw cycles Amino Acid Sequence: SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG Scientific Category: Cytokine/Growth Factors Product Type: Recombinant Protein Data shown is lot-specific. Contact us for specific information on other lots.