p.chemkody:after{ content:""; display:block; overflow:hidden; clear:both; height:0; } p.chemkody span:nth-of-type(7n+1) { clear: left; } p.chemkody span { float: left; min-width: 90px; margin: 0 20px 0 0; padding: 0 0 10px; color: #6e6e6e; font-family: Courier New,monospace; white-space: nowrap; } Regulatory status:RUO Type:Recombinant Source:E. coli Other names:Adipocyte C1q and collagen domain-containing protein, Adipocyte complement-related 30 kDa protein, ACRP30, Adipose most abundant gene transcript 1 protein, apM-1, Gelatin-binding protein, ADIPOQ, ACDC, APM1, GBP28 Species:Human Type Recombinant Description Total 242 AA. MW: 26.4 kDa (calculated). UniProtKB acc.no. Q15848. N-Terminal His-tag, 12 extra AA (highlighted). Amino Acid Sequence MRGSHHHHHHGSGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN Source E. coli Purity Purity as determined by densitometric image analysis: >95% SDS-PAGE Gel 12% SDS-PAGE separation of Human Adiponectin (E.coli) 1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa 2. reduced and heated sample, 2.5μg/lane 3. non-reduced and non-heated sample, 2.5μg/lane Endotoxin < 1.0 EU/ug Formulation Filtered (0.4 μm) and lyophilized from 0.5 mg/mL in 20mM Tris buffer, 50 mM NaCl, pH 7.5 Reconstitution Add 200µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture. Applications Western blotting, ELISA Shipping At ambient temperature. Upon receipt, store the product at the temperature recommended below. Storage/Expiration Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week. Quality Control Test BCA to determine quantity of the protein. SDS PAGE to determine purity of the protein. LAL to determine quantity of endotoxin.